PaperBLAST – Find papers about a protein or its homologs

 

Align P55874 to TIGR00001

P55874 has 66 amino acids

Query:       TIGR00001  [M=63]
Accession:   TIGR00001
Description: rpmI_bact: ribosomal protein bL35
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.1e-31   94.3  11.4    2.3e-31   94.2  11.4    1.0  1  P55874    


Domain annotation for each sequence (and alignments):
>> P55874  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.2  11.4   2.3e-31   2.3e-31       1      62 [.       2      63 ..       2      64 .. 0.98

  Alignments for each domain:
  == domain 1  score: 94.2 bits;  conditional E-value: 2.3e-31
  TIGR00001  1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllLp 62
               pKmKT++++aKRFk+tgsGk+kr++a+++Hl+++Ks+k+kR+Lrk+a+vs++d kr+k++L 
     P55874  2 PKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVSAGDFKRIKQMLA 63
               9***********************************************************96 PP



Or compare P55874 to CDD or PaperBLAST