P67605 has 111 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-50 153.6 8.8 7e-50 153.4 8.8 1.0 1 P67605
Domain annotation for each sequence (and alignments):
>> P67605
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 153.4 8.8 7e-50 7e-50 1 93 [] 8 100 .. 8 100 .. 0.98
Alignments for each domain:
== domain 1 score: 153.4 bits; conditional E-value: 7e-50
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklkel 93
+++vle+vr +rrknkl+rei+d+ekkirdnqkrv+ll+nl++yikp ms+e i+ ii++mksdyedrvddyiiknae+skerr++skklk++
P67605 8 FQDVLEFVRLFRRKNKLQREIQDIEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKSDYEDRVDDYIIKNAEISKERRDISKKLKAM 100
689***************************************************************************************975 PP
Or compare P67605 to CDD or PaperBLAST