PaperBLAST – Find papers about a protein or its homologs

 

Align P67605 to PF04363 (DUF496)

P67605 has 111 amino acids

Query:       DUF496  [M=93]
Accession:   PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.9e-49  152.1   8.7    2.2e-49  151.9   8.7    1.1  1  P67605    


Domain annotation for each sequence (and alignments):
>> P67605  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.9   8.7   2.2e-49   2.2e-49       1      93 []       8     100 ..       8     100 .. 0.98

  Alignments for each domain:
  == domain 1  score: 151.9 bits;  conditional E-value: 2.2e-49
  DUF496   1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklkel 93 
             +++vle+vr +rrknkl+rei+d+ekkirdn+krv ll+nl++yikp ms e i+ ii+ mksdyedrvddyiik+ae+skerr++skklk++
  P67605   8 FQDVLEFVRLFRRKNKLQREIQDIEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKSDYEDRVDDYIIKNAEISKERRDISKKLKAM 100
             699***************************************************************************************976 PP



Or compare P67605 to CDD or PaperBLAST