P69682 has 277 amino acids
Query: DUF1681 [M=158] Accession: PF07933.18 Description: Protein of unknown function (DUF1681) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-65 204.4 0.0 5.4e-65 204.1 0.0 1.1 1 P69682 Domain annotation for each sequence (and alignments): >> P69682 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.1 0.0 5.4e-65 5.4e-65 1 158 [] 7 164 .. 7 164 .. 0.95 Alignments for each domain: == domain 1 score: 204.1 bits; conditional E-value: 5.4e-65 DUF1681 1 iervllvakevhvYkippltsskgyraadWtakepiwtgrlrvvekgkkvdikLedkktgelfaaapve.tkeaavekvlDSsRyFvlrvedekgrkaflGi 101 +e+vl+v+++v+vY+ipp++s++gyra+dW+ ++p wtgrlr+++kgk + ikLedk +gelfa+apve ave+v DSsRyFv+r++d +gr+af+Gi P69682 7 YESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEqYPGIAVETVADSSRYFVIRIQDGTGRSAFIGI 108 799*****************************************************************9755689*************************** PP DUF1681 102 gFeeRsdafdfnvalqdaekrlkkekeaeekekeeeekkekkdysLkeGetikinlg 158 gF++R dafdfnv+lqd++k++k+e+e ++ e++e +++ k d+ +keG+tik+++g P69682 109 GFTDRGDAFDFNVSLQDHFKWVKQETEISK-ESQEMDSRPKLDLGFKEGQTIKLSIG 164 ****************************97.556666666**************986 PP
Or compare P69682 to CDD or PaperBLAST