P72541 has 129 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-20 59.8 0.1 1.6e-20 59.6 0.1 1.1 1 P72541
Domain annotation for each sequence (and alignments):
>> P72541
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.6 0.1 1.6e-20 1.6e-20 1 78 [. 26 103 .. 26 104 .. 0.98
Alignments for each domain:
== domain 1 score: 59.6 bits; conditional E-value: 1.6e-20
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+++d+ D+ ll+ R++++ +i+eyK+ +++p+++p R ++v +++++ a+++g+dp ++++++++ii e+++l+
P72541 26 RARLDAADAALLDAVRTRLDICLRIGEYKRLHQVPMMQPHRIAQVHANAARYAADHGIDPAFLRTLYDTIITETCRLE 103
99*************************************************9*9********************9998 PP
Or compare P72541 to CDD or PaperBLAST