P76065 has 285 amino acids
Query: DUF1376 [M=87]
Accession: PF07120.15
Description: Protein of unknown function (DUF1376)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-31 92.6 0.2 1.4e-30 91.9 0.2 1.4 1 P76065
Domain annotation for each sequence (and alignments):
>> P76065
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.9 0.2 1.4e-30 1.4e-30 1 86 [. 22 104 .. 22 105 .. 0.94
Alignments for each domain:
== domain 1 score: 91.9 bits; conditional E-value: 1.4e-30
DUF1376 1 nYyphhigdyardtahLsalEhgaYllLldlyydtegplpdDdkrlarlagarteeeraaveavLaeffelsdggwvnarceeeia 86
+Y++++i+dy +dt+hLsa+EhgaYllL+++y++t++p+p+++ la++a+ ++e++ a+ve+ L+eff wv+ r+ee++a
P76065 22 PYMQLYIADYLADTMHLSAEEHGAYLLLMFNYWQTGKPIPKNR--LAKIARLTNERW-ADVEPSLQEFFCDNGEEWVHLRIEEDLA 104
8***************************************886..************.**********9666666********997 PP
Or compare P76065 to CDD or PaperBLAST