P82411 has 116 amino acids
Query: DUF5323 [M=62]
Accession: PF17257.6
Description: Family of unknown function (DUF5323)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-39 119.0 1.0 4.7e-39 118.5 1.0 1.2 1 P82411
Domain annotation for each sequence (and alignments):
>> P82411
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.5 1.0 4.7e-39 4.7e-39 2 60 .. 39 97 .. 38 99 .. 0.95
Alignments for each domain:
== domain 1 score: 118.5 bits; conditional E-value: 4.7e-39
DUF5323 2 gkgglviecSSRPqKKataHHmKtRPrKtqawDirRkPtvYapLPpLPpdwtlvssaed 60
g+g ++iecSSRPqKK+taHHmKtRP+Kt wDi+R+P+vY+pLPpLP++wt+vssa d
P82411 39 GGGVITIECSSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVSSAVD 97
78899**************************************************9876 PP
Or compare P82411 to CDD or PaperBLAST