P9WIB9 has 199 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-17 48.9 0.5 1.1e-16 47.4 0.1 1.9 2 P9WIB9 Domain annotation for each sequence (and alignments): >> P9WIB9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.1 1.1e-16 1.1e-16 10 78 .. 41 109 .. 40 110 .. 0.96 2 ? -1.1 0.0 0.15 0.15 1 13 [. 134 146 .. 134 148 .. 0.84 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 1.1e-16 CM_2 10 elleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 el++ aeR+e+a+ +a++K +++lp+ d R+e++l++l e+a+++++dp++v+++f++ i+++ a++ P9WIB9 41 ELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIE 109 89******************99999*************************************9998887 PP == domain 2 score: -1.1 bits; conditional E-value: 0.15 CM_2 1 RkeIdeiDrelle 13 R+ Id++++++l P9WIB9 134 RSAIDSLNNRMLS 146 8899999999985 PP
Or compare P9WIB9 to CDD or PaperBLAST