Q06321 has 1198 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-18 52.4 0.0 5.3e-18 51.5 0.0 1.3 1 Q06321
Domain annotation for each sequence (and alignments):
>> Q06321
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 51.5 0.0 5.3e-18 5.3e-18 25 128 .. 1040 1141 .. 1031 1147 .. 0.88
Alignments for each domain:
== domain 1 score: 51.5 bits; conditional E-value: 5.3e-18
EryCIII-like_C 25 dlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpa 117
+lp n+ ++ vP + l p+ +a vHhgG+g+t ++l +G+P v+ p + d++ a rv ++G gi+l+k l+++++a+a++ + ++
Q06321 1040 TEVDLPRNILNIGNVPHDWLFPQVDAAVHHGGSGTTGASLRAGLPTVIKPFFGDQFFYAGRVEDIGVGIALKK--LNAQTLADALKVATTNKI 1130
44579******************************************************************86..678889999988888888 PP
EryCIII-like_C 118 yraaaaklaee 128
++ a+ +++
Q06321 1131 MKDRAGLIKKK 1141
88887766655 PP
Or compare Q06321 to CDD or PaperBLAST