Q07448 has 255 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-24 71.2 0.0 5.8e-24 70.5 0.0 1.3 1 Q07448
Domain annotation for each sequence (and alignments):
>> Q07448
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.5 0.0 5.8e-24 5.8e-24 1 100 [. 152 248 .. 152 251 .. 0.91
Alignments for each domain:
== domain 1 score: 70.5 bits; conditional E-value: 5.8e-24
AadA_C 1 evldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveefakym 100
e+l+++p +d+++ai+++ eel+++ ++de++ +LtL+R+++t+ tg+i++Kd A++ + e+ P e+r+ + A + ylg e++e+ +e+v+ +y+
Q07448 152 ELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLG---ENIEWTNENVNLTINYL 248
699*****************************************************************************...56666666666666665 PP
Or compare Q07448 to CDD or PaperBLAST