Q0D9B8 has 931 amino acids
Query: DUF4378 [M=166] Accession: PF14309.10 Description: Domain of unknown function (DUF4378) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-26 77.6 0.1 7.6e-26 77.6 0.1 3.4 3 Q0D9B8 Domain annotation for each sequence (and alignments): >> Q0D9B8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.1 0.1 0.025 0.025 84 116 .. 173 205 .. 158 239 .. 0.73 2 ? 0.4 1.7 0.041 0.041 94 121 .. 364 391 .. 293 438 .. 0.59 3 ! 77.6 0.1 7.6e-26 7.6e-26 2 165 .. 756 917 .. 755 918 .. 0.85 Alignments for each domain: == domain 1 score: 1.1 bits; conditional E-value: 0.025 DUF4378 84 yppskvssassrrrpkklsgeelleevwseirs 116 ++ +++ ++r r++++++++ ee+ ++ir+ Q0D9B8 173 DYTYRHCLKKMRPRRSRSRQHHPQEELLEKIRE 205 444556667777788888888999999999986 PP == domain 2 score: 0.4 bits; conditional E-value: 0.041 DUF4378 94 srrrpkklsgeelleevwseirswlspe 121 s++ +++ ++ee leev +++++ l+ + Q0D9B8 364 SSKVKREGNMEEFLEEVKERLKKELKLK 391 3333444566777777777777522222 PP == domain 3 score: 77.6 bits; conditional E-value: 7.6e-26 DUF4378 2 leYvrdiLeasglllkd......sdellsrwhsses...pldpslfeeleekkgsaseeetresrserklLFDlvneiLveilelfkrsfsyppskvssass 94 +Y++++L a gl+ + s + +r +s p+ +f+e+ee+++ t+e ++++LFDl ne+L+ + ++++ s+ +++v ++ Q0D9B8 756 MAYIKQVLIAVGLYEDGssysspSMMNNARVDS--MarrPICDYVFDEVEETYN------TEEDAADHRMLFDLANEALEITMMGSTKTGSSLWRWVVDSTG 849 68***********86668887643333344444..1457**************6......6799***************99977667889999999877755 PP DUF4378 95 rrrpkklsgeelleevwseirswlspe...selvldelvdkdlssregkwl.dledeveeigleierlIledLve 165 + g++ll +vw++++s++ p+ + ++++++v+++ ++ w+ l+++++ +g+++er I+++L+ Q0D9B8 850 V-----SPGRKLLVDVWQQVQSVRNPPvqqETQTVESMVAREAWTS--PWIeVLHEDSYVLGRKLERAIFDQLIA 917 3.....5699************99999*****************99..***999*******************97 PP
Or compare Q0D9B8 to CDD or PaperBLAST