Q0PBJ3 has 357 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-27 81.8 0.5 3.9e-27 80.8 0.5 1.6 1 Q0PBJ3
Domain annotation for each sequence (and alignments):
>> Q0PBJ3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.8 0.5 3.9e-27 3.9e-27 1 78 [. 8 84 .. 8 85 .. 0.95
Alignments for each domain:
== domain 1 score: 80.8 bits; conditional E-value: 3.9e-27
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R++Id++D+++l+Ll+eRm ++k i+e+K+++g ++++peRe+++++rl++ a+ ld++a+e+i++ei++ sr+l+
Q0PBJ3 8 RNKIDAVDDKILDLLNERMTYVKSIGELKQSSGGSIYRPERERAIINRLKN-ANLGLLDQNAIEAIYQEIFAVSRNLE 84
99************************************************9.444569******************98 PP
Or compare Q0PBJ3 to CDD or PaperBLAST