Q0VCQ6 has 212 amino acids
Query: PDC10_C [M=90] Accession: PF06840.15 Description: Programmed cell death protein 10, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-44 136.0 1.6 3.8e-44 135.0 1.6 1.5 1 Q0VCQ6 Domain annotation for each sequence (and alignments): >> Q0VCQ6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.0 1.6 3.8e-44 3.8e-44 1 90 [] 74 161 .. 74 161 .. 0.98 Alignments for each domain: == domain 1 score: 135.0 bits; conditional E-value: 3.8e-44 PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 vn++eslLr+a++ dveey+ier e efq+ln+karaLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale Q0VCQ6 74 VNFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161 8************.********************************************************************.8899997 PP
Or compare Q0VCQ6 to CDD or PaperBLAST