Q1Q5F8 has 158 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-10 25.7 0.3 5.2e-10 25.7 0.3 1.7 2 Q1Q5F8 Domain annotation for each sequence (and alignments): >> Q1Q5F8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.1 0.079 0.079 109 148 .. 21 60 .. 6 65 .. 0.64 2 ! 25.7 0.3 5.2e-10 5.2e-10 101 154 .. 88 141 .. 72 146 .. 0.91 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.079 DUF892 109 EiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLte 148 i Y + + ++e+ g + e e++ eE + +ekL e Q1Q5F8 21 AINQYFVHAKMCENWGYKRLYEFNEKNSIEEMKHAEKLIE 60 4555666666666666666666666666666666666654 PP == domain 2 score: 25.7 bits; conditional E-value: 5.2e-10 DUF892 101 aaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelv 154 +a+e+ i +++ i+l+ ++g+a +elLe +l E++ +++L+e+++++ Q1Q5F8 88 NDYALEKIAIQRLQKSITLCAEVGDAGSRELLEHILTDEEKHANDLEEHLQQIK 141 57899*********************************************9876 PP
Or compare Q1Q5F8 to CDD or PaperBLAST