Q2G178 has 163 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-55 174.0 6.4 1.3e-55 173.7 6.4 1.1 1 Q2G178 Domain annotation for each sequence (and alignments): >> Q2G178 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.7 6.4 1.3e-55 1.3e-55 1 145 [. 7 151 .. 7 152 .. 0.98 Alignments for each domain: == domain 1 score: 173.7 bits; conditional E-value: 1.3e-55 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltlslkk 100 l+++Y+eia++i++miP+eWekvy++a++++++gev+F+y+k++s++l+y+++ip++yn+s +++++l+++Ly+l++elr+ fk+e+ e+Wt++++++++ Q2G178 7 LSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNIPKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTR 106 689************************************************************************************************* PP YezG-like 101 sGklkiefnyddllnseldsserkiiwkykklgilpeeekekell 145 +G+lk++f+y d++nse+ + r++++ky+k+gilpe+e+e +++ Q2G178 107 EGELKVSFDYIDWINSEFGQIGRQNYYKYRKFGILPETEYEINKV 151 ***************************************998876 PP
Or compare Q2G178 to CDD or PaperBLAST