Q3U595 has 105 amino acids
Query: PANTS-like [M=80] Accession: PF11326.13 Description: Synaptic plasticity regulator PANTS-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-20 58.7 3.4 3.5e-20 58.5 3.4 1.1 1 Q3U595 Domain annotation for each sequence (and alignments): >> Q3U595 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.5 3.4 3.5e-20 3.5e-20 2 80 .] 11 88 .. 10 88 .. 0.96 Alignments for each domain: == domain 1 score: 58.5 bits; conditional E-value: 3.5e-20 PANTS-like 2 mscreafdellsCyslggqfknyYryGelksCsekwedfkfClrlkekkeeeaqealrereeekkakrkkssedvWelR 80 ++c+ + e+ C s+g+ +++yY++G+ ++C ++ +d+ +C +++e++++eaq+ l e+e+ + + ++++ vW lR Q3U595 11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQAA-QKHTLVWALR 88 6899************************************************************9886.99999**998 PP
Or compare Q3U595 to CDD or PaperBLAST