PaperBLAST – Find papers about a protein or its homologs

 

Align Q3U595 to PF11326 (PANTS-like)

Q3U595 has 105 amino acids

Query:       PANTS-like  [M=80]
Accession:   PF11326.13
Description: Synaptic plasticity regulator PANTS-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      3e-20   58.7   3.4    3.5e-20   58.5   3.4    1.1  1  Q3U595    


Domain annotation for each sequence (and alignments):
>> Q3U595  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   58.5   3.4   3.5e-20   3.5e-20       2      80 .]      11      88 ..      10      88 .. 0.96

  Alignments for each domain:
  == domain 1  score: 58.5 bits;  conditional E-value: 3.5e-20
  PANTS-like  2 mscreafdellsCyslggqfknyYryGelksCsekwedfkfClrlkekkeeeaqealrereeekkakrkkssedvWelR 80
                ++c+ +  e+  C s+g+ +++yY++G+ ++C ++ +d+ +C +++e++++eaq+ l e+e+ + +   ++++ vW lR
      Q3U595 11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQAA-QKHTLVWALR 88
                6899************************************************************9886.99999**998 PP



Or compare Q3U595 to CDD or PaperBLAST