Q3UDW8 has 656 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.9
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-10 27.4 0.8 1.2e-10 27.4 0.8 2.5 3 Q3UDW8
Domain annotation for each sequence (and alignments):
>> Q3UDW8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -0.1 0.0 0.028 0.028 3 18 .. 262 277 .. 260 281 .. 0.86
2 ! 27.4 0.8 1.2e-10 1.2e-10 48 104 .. 294 350 .. 286 389 .. 0.88
3 ? -4.2 0.1 0.53 0.53 110 157 .. 619 640 .. 613 653 .. 0.38
Alignments for each domain:
== domain 1 score: -0.1 bits; conditional E-value: 0.028
DUF5009 3 ksldalrGiaillmvl 18
+++d++rG+a++lmv+
Q3UDW8 262 RCVDTFRGLALVLMVF 277
679***********97 PP
== domain 2 score: 27.4 bits; conditional E-value: 1.2e-10
DUF5009 48 pGitwvdlvfpfflfamGaaiplalkkkvekgssklkvlldiikrfvlltffalftm 104
G+t dlvfp+f+f mG++i l+++ ++g sklk+l +i+ r ll+ + +
Q3UDW8 294 NGLTVADLVFPWFVFIMGTSIFLSMTSILQRGCSKLKLLGKIVWRSFLLICIGVIIV 350
699******************************************999998887765 PP
== domain 3 score: -4.2 bits; conditional E-value: 0.53
DUF5009 110 vlssepelkeqllsivcfvllfllylsikkklkkkaalvikvvaflla 157
l+ e+ ke+l++ ++va +l
Q3UDW8 619 KLADEQSHKEHLIQ--------------------------NIVATALW 640
44444444444433..........................22222221 PP
Or compare Q3UDW8 to CDD or PaperBLAST