Q4VR96 has 264 amino acids
Query: AadA_C [M=103] Accession: PF13427.10 Description: Aminoglycoside adenylyltransferase, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-27 80.5 0.0 1.7e-26 78.6 0.0 1.9 2 Q4VR96 Domain annotation for each sequence (and alignments): >> Q4VR96 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.16 0.16 16 30 .. 11 25 .. 7 29 .. 0.80 2 ! 78.6 0.0 1.7e-26 1.7e-26 1 100 [. 152 249 .. 152 251 .. 0.95 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.16 AadA_C 16 ladveelleeieede 30 +++v+e+++ei +d+ Q4VR96 11 MKQVNEWVKEILQDN 25 678999999999886 PP == domain 2 score: 78.6 bits; conditional E-value: 1.7e-26 AadA_C 1 evldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveefakym 100 ev+++vp+e+++d+ +d +++eei ++++y +L+L+R +a ++++ lsK +++wale++ ++y++++++A++ yl+ +++ ++d+ +++efa+++ Q4VR96 152 EVFSKVPKEYIIDSNYSDTLDCVEEIVNNPVYCILNLCRFYALIRDDLTLSKYDGGKWALENMNSNYNDVIKNAMEDYLS--DTNNSYDNTRLKEFAQEA 249 79******************************************************************************..6667789999****9976 PP
Or compare Q4VR96 to CDD or PaperBLAST