Q4VR99 has 258 amino acids
Query: AadA_C [M=103] Accession: PF13427.10 Description: Aminoglycoside adenylyltransferase, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-31 94.1 0.0 1.9e-30 91.4 0.0 2.2 3 Q4VR99 Domain annotation for each sequence (and alignments): >> Q4VR99 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.082 0.082 60 80 .. 3 23 .. 2 26 .. 0.85 2 ? -2.9 0.0 0.43 0.43 8 23 .. 52 67 .. 50 72 .. 0.73 3 ! 91.4 0.0 1.9e-30 1.9e-30 1 103 [] 148 250 .. 148 250 .. 0.98 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.082 AadA_C 60 lerlPeeyrpllaeArkaylg 80 ++++P++ +++++ A + +g Q4VR99 3 INEFPQQVNQVISIAETILQG 23 6789*********99988777 PP == domain 2 score: -2.9 bits; conditional E-value: 0.43 AadA_C 8 redlvdailadveell 23 +++l ++i+ad+++ l Q4VR99 52 KQELSNSIRADLTKQL 67 6788999999987655 PP == domain 3 score: 91.4 bits; conditional E-value: 1.9e-30 AadA_C 1 evldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveefakymlae 103 e+++++p ++ +ai+ ++++l+++ ++der+v+LtL R++ tl t+ei+ Kd Aa+w++ +lPe++ pll A++aylg+ ++we+ e+e+ ++++ym+++ Q4VR99 148 ELIPAIPFHEIKKAIRFSLPGLISSFKGDERNVLLTLSRMWFTLVTEEITTKDVAAKWVILKLPERFPPLLTTAKEAYLGNLSDEWETVEKEAMALVEYMKKQ 250 6899************************************************************************************************985 PP
Or compare Q4VR99 to CDD or PaperBLAST