Q5D8L4 has 216 amino acids
Query: PDC10_C [M=90] Accession: PF06840.15 Description: Programmed cell death protein 10, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-23 67.1 0.2 1.4e-22 65.9 0.0 1.7 2 Q5D8L4 Domain annotation for each sequence (and alignments): >> Q5D8L4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.24 0.24 15 33 .. 35 54 .. 28 56 .. 0.51 2 ! 65.9 0.0 1.4e-22 1.4e-22 1 90 [] 77 165 .. 77 165 .. 0.94 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.24 PDC10_C 15 dveeyii.erkeeefqelnk 33 + e+y + +r +e+f +++k Q5D8L4 35 EKENYSLtQRLKEAFYKVEK 54 44555541344556666555 PP == domain 2 score: 65.9 bits; conditional E-value: 1.4e-22 PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 ++++e+ Lr+a+ +++++ +++r+ el+ a++Lk+iLs iPdei+dR++f+e ik iA aik lL av + + + ++kk le Q5D8L4 77 IDVTETCLRIAALQECDNPRTSRN-PRVLELELTAKTLKTILSSIPDEITDRRAFIEVIKGIADAIKMLLAAVGAFYDALPPGTQKKCLE 165 789**********99999888775.6789***************************************************9999999987 PP
Or compare Q5D8L4 to CDD or PaperBLAST