PaperBLAST – Find papers about a protein or its homologs

 

Align Q5D8L4 to PF06840 (PDC10_C)

Q5D8L4 has 216 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      6e-23   67.1   0.2    1.4e-22   65.9   0.0    1.7  2  Q5D8L4    


Domain annotation for each sequence (and alignments):
>> Q5D8L4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.1      0.24      0.24      15      33 ..      35      54 ..      28      56 .. 0.51
   2 !   65.9   0.0   1.4e-22   1.4e-22       1      90 []      77     165 ..      77     165 .. 0.94

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.24
  PDC10_C 15 dveeyii.erkeeefqelnk 33
             + e+y + +r +e+f +++k
   Q5D8L4 35 EKENYSLtQRLKEAFYKVEK 54
             44555541344556666555 PP

  == domain 2  score: 65.9 bits;  conditional E-value: 1.4e-22
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              ++++e+ Lr+a+ +++++ +++r+     el+  a++Lk+iLs iPdei+dR++f+e ik iA aik lL av + +   +  ++kk le
   Q5D8L4  77 IDVTETCLRIAALQECDNPRTSRN-PRVLELELTAKTLKTILSSIPDEITDRRAFIEVIKGIADAIKMLLAAVGAFYDALPPGTQKKCLE 165
              789**********99999888775.6789***************************************************9999999987 PP



Or compare Q5D8L4 to CDD or PaperBLAST