Q5REA8 has 123 amino acids
Query: TXD17-like_Trx [M=119] Accession: PF06110.17 Description: Thioredoxin domain-containing protein 17-like, thioredoxin domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-51 158.9 0.0 2.3e-51 158.7 0.0 1.0 1 Q5REA8 Domain annotation for each sequence (and alignments): >> Q5REA8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 158.7 0.0 2.3e-51 2.3e-51 2 119 .] 9 122 .. 8 122 .. 0.97 Alignments for each domain: == domain 1 score: 158.7 bits; conditional E-value: 2.3e-51 EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEEE CS TXD17-like_Trx 2 vkgfeefekkvkelekesktvfilFsgekdteGesWCPdCvkaepvieealkeapedvklvvvdvGdrevWkdpanefRkdpklkltavPtLlrw 96 v gfeef+++v++ ++ kt+f++F+g+kd G+sWCPdCv+aepv++e+lk+++e +++++++vG++++Wkdp+n+fRk +lk+tavPtL+++ Q5REA8 9 VSGFEEFHRAVEQ--HNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRK--NLKVTAVPTLIKY 99 789********99..7789*************************************************************..89*********** PP TSS-EE-HHHHH-HHHHHHHHH- CS TXD17-like_Trx 97 kgkkrLeeeqllkssLvellfee 119 +++++L+e+++l+ +Lve+lf+e Q5REA8 100 GTPQKLVESECLQANLVEMLFSE 122 *********************87 PP
Or compare Q5REA8 to CDD or PaperBLAST