Q5RJZ6 has 122 amino acids
Query: DUF2205 [M=75]
Accession: PF10224.13
Description: Short coiled-coil protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-31 93.5 3.3 5.2e-31 92.9 3.3 1.3 1 Q5RJZ6
Domain annotation for each sequence (and alignments):
>> Q5RJZ6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.9 3.3 5.2e-31 5.2e-31 10 74 .. 52 116 .. 42 117 .. 0.92
Alignments for each domain:
== domain 1 score: 92.9 bits; conditional E-value: 5.2e-31
DUF2205 10 leklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitssts 74
+++e e++++L++q+ eLq++L++l++rvdaVkee++KL+sen++L++YI++Lms+s+++++t+
Q5RJZ6 52 ENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTD 116
578999*********************************************************97 PP
Or compare Q5RJZ6 to CDD or PaperBLAST