Q5RJZ6 has 122 amino acids
Query: DUF2205 [M=75] Accession: PF10224.14 Description: Short coiled-coil protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 93.5 3.3 5.2e-31 92.9 3.3 1.3 1 Q5RJZ6 Domain annotation for each sequence (and alignments): >> Q5RJZ6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.9 3.3 5.2e-31 5.2e-31 10 74 .. 52 116 .. 42 117 .. 0.92 Alignments for each domain: == domain 1 score: 92.9 bits; conditional E-value: 5.2e-31 DUF2205 10 leklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitssts 74 +++e e++++L++q+ eLq++L++l++rvdaVkee++KL+sen++L++YI++Lms+s+++++t+ Q5RJZ6 52 ENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTD 116 578999*********************************************************97 PP
Or compare Q5RJZ6 to CDD or PaperBLAST