Q5SV66 has 316 amino acids
Query: DUF4200 [M=119] Accession: PF13863.11 Description: Domain of unknown function (DUF4200) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-32 98.8 30.5 1.4e-32 98.8 30.5 3.2 3 Q5SV66 Domain annotation for each sequence (and alignments): >> Q5SV66 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.8 30.5 1.4e-32 1.4e-32 1 118 [. 44 161 .. 44 162 .. 0.99 2 ! 6.4 3.1 0.00059 0.00059 8 67 .. 168 227 .. 164 247 .. 0.68 3 ? 2.0 2.7 0.014 0.014 72 107 .. 272 307 .. 269 313 .. 0.80 Alignments for each domain: == domain 1 score: 98.8 bits; conditional E-value: 1.4e-32 DUF4200 1 llekkremflvqealdakkeeierleellkereeelekkeqelkedlvkfdkflkeneakreraekkaeeetkekkekekeikklkaeleelkseiskleek 102 llekk+e +qea+++kke ++r++e+l+ r+eel ke++lk++++kf++f++en++kr ra+kka++e+++k+ + +e++k+k+e+++l+ e++kl k Q5SV66 44 LLEKKKEAKIMQEAMEHKKEAFQRRMETLNLRWEELGIKEEQLKAHIQKFEQFIQENDQKRIRALKKANKERELKRLRLRELAKAKQEMMALRLEHQKLSVK 145 79**************************************************************************************************** PP DUF4200 103 leeykkYekfLekvvp 118 l++y +++k+Lekvv+ Q5SV66 146 LQDYAIFNKYLEKVVE 161 **************98 PP == domain 2 score: 6.4 bits; conditional E-value: 0.00059 DUF4200 8 mflvqealdakkeeierleellkereeelekkeqelkedlvkfdkflkeneakreraekk 67 + +v + +++ + ++ l+++++e +e++e+++++l + +++ d+ + +++++ +r + + Q5SV66 168 IHEVIARYKTLVSMHHDLMQSAQEGQEKIERAKARLARYMEEKDDEILQHNNELARLQMR 227 555555566666667777777777777777777777777766666555555555554444 PP == domain 3 score: 2.0 bits; conditional E-value: 0.014 DUF4200 72 tkekkekekeikklkaeleelkseiskleekleeyk 107 +++k++ + +++ +++l+ ++++i+ l + e k Q5SV66 272 KQLKESTQVSLEDTHKQLDMIQQFIQDLSDIWTEVK 307 577888888899999999999999999988777666 PP
Or compare Q5SV66 to CDD or PaperBLAST