Q5T5A4 has 169 amino acids
Query: DUF3695 [M=101]
Accession: PF12494.12
Description: Protein of unknown function (DUF3695)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-46 142.1 0.6 3.2e-46 141.6 0.6 1.2 1 Q5T5A4
Domain annotation for each sequence (and alignments):
>> Q5T5A4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 141.6 0.6 3.2e-46 3.2e-46 2 97 .. 30 123 .. 29 127 .. 0.96
Alignments for each domain:
== domain 1 score: 141.6 bits; conditional E-value: 3.2e-46
DUF3695 2 pfknptklaqqlepweRLfstqtlsSvrreayffdpkiPkDsLDfrLaarYdhhteafkekneillqqeTiqdtsgrvlknfptevlsppkedplt 97
p+knpt+laqq+epw+RL+st+t++S+rr+ay+fdp+iPkD+LDfrLaa+Y+hht++fk+k+eill+q+T+qdt + ++ +fp+e+l+pp++ p+t
Q5T5A4 30 PYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYR-TKIQFPGEFLTPPTP-PIT 123
79**********************************************************************9987.*************99.776 PP
Or compare Q5T5A4 to CDD or PaperBLAST