Q5T6F2 has 1119 amino acids
Query: UBAP2-Lig [M=33]
Accession: PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-22 64.0 0.5 1.5e-21 62.6 0.5 1.8 1 Q5T6F2
Domain annotation for each sequence (and alignments):
>> Q5T6F2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.6 0.5 1.5e-21 1.5e-21 1 33 [] 512 544 .. 512 544 .. 0.99
Alignments for each domain:
== domain 1 score: 62.6 bits; conditional E-value: 1.5e-21
UBAP2-Lig 1 PpSkIPasAVEMPgdanissLDVQFGaldFGse 33
P+SkIPasAVEMPg+a++ +L+VQFGal+FGse
Q5T6F2 512 PASKIPASAVEMPGSADVTGLNVQFGALEFGSE 544
9*******************************8 PP
Or compare Q5T6F2 to CDD or PaperBLAST