Q5TGZ0 has 78 amino acids
Query: DUF543 [M=75]
Accession: PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-30 90.3 0.5 3.3e-30 90.2 0.5 1.0 1 Q5TGZ0
Domain annotation for each sequence (and alignments):
>> Q5TGZ0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.2 0.5 3.3e-30 3.3e-30 14 74 .. 2 62 .. 1 63 [. 0.97
Alignments for each domain:
== domain 1 score: 90.2 bits; conditional E-value: 3.3e-30
DUF543 14 sesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasF 74
ses+l +kwD+cL++++vk+g G+g G+v+s+ +f+rR++p ++G G+GlG+aY++c+ +F
Q5TGZ0 2 SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDF 62
5799*******************************************************99 PP
Or compare Q5TGZ0 to CDD or PaperBLAST