PaperBLAST – Find papers about a protein or its homologs

 

Align Q5TGZ0 to PF04418 (DUF543)

Q5TGZ0 has 78 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.9e-30   90.3   0.5    3.3e-30   90.2   0.5    1.0  1  Q5TGZ0    


Domain annotation for each sequence (and alignments):
>> Q5TGZ0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.2   0.5   3.3e-30   3.3e-30      14      74 ..       2      62 ..       1      63 [. 0.97

  Alignments for each domain:
  == domain 1  score: 90.2 bits;  conditional E-value: 3.3e-30
  DUF543 14 sesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasF 74
            ses+l +kwD+cL++++vk+g G+g G+v+s+ +f+rR++p ++G G+GlG+aY++c+ +F
  Q5TGZ0  2 SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDF 62
            5799*******************************************************99 PP



Or compare Q5TGZ0 to CDD or PaperBLAST