Q66K66 has 360 amino acids
Query: DUF4203 [M=201] Accession: PF13886.10 Description: Domain of unknown function (DUF4203) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-50 157.3 28.7 2.5e-50 157.1 28.7 1.1 1 Q66K66 Domain annotation for each sequence (and alignments): >> Q66K66 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.1 28.7 2.5e-50 2.5e-50 2 201 .] 41 236 .. 40 236 .. 0.92 Alignments for each domain: == domain 1 score: 157.1 bits; conditional E-value: 2.5e-50 DUF4203 2 lgailillGlvycffGyrlfkltlflsgfllgslivlvlilkvmvlpsslvqgaflvaavvaGllgGllallfwelglfllgllgGlllallllslleggli 103 ++++++l+G+vycffGyr+fk++lfl+g+l+gs+++++l+++++vl+++l+ ga++++a+++Gll+Gl+a+l++++glfl+gll+Gllla ++l ++ Q66K66 41 VCIMCCLFGVVYCFFGYRCFKAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFLVGLLLGLLLAAAALLGS-APYY 141 8******************************************************************************************999999.5666 PP DUF4203 104 tslpakaif...vlivvlalvgavlslslqkyllivstsvvGatavvlgiDyfvgaglkefll.nlfpratvalltypltrgiwvllaaiivlallgvlvQl 201 ++ + ++ +l+++ +l++a+l+l+++++l+ ++t+v Ga+++ + Dyf++ l ++ + + + a +pl + +w+lla++++l+l+gvlvQ+ Q66K66 142 QPGS---VWgplGLLLGGGLLCALLTLRWPRPLTTLATAVTGAALIATAADYFAELLLLGRYVvERL---R-AAPVPPLCWRSWALLALWPLLSLMGVLVQW 236 6444...44556********************************************97775553333...3.4558*************************9 PP
Or compare Q66K66 to CDD or PaperBLAST