Q6IPT2 has 247 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-18 52.7 0.6 3.1e-18 52.1 0.6 1.3 1 Q6IPT2
Domain annotation for each sequence (and alignments):
>> Q6IPT2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.1 0.6 3.1e-18 3.1e-18 6 61 .. 180 235 .. 175 241 .. 0.93
Alignments for each domain:
== domain 1 score: 52.1 bits; conditional E-value: 3.1e-18
GARIL_Rab2_bd 6 rllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLr 61
l+Plkfv+l v+dk+ ++l +kl t R+fyl+L ++ ++++ f +w+rl++ Lr
Q6IPT2 180 GLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLR 235
589*************************************************9887 PP
Or compare Q6IPT2 to CDD or PaperBLAST