Q6NXP2 has 309 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.7e-30 89.7 1.5 1.1e-29 88.8 1.5 1.5 1 Q6NXP2
Domain annotation for each sequence (and alignments):
>> Q6NXP2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.8 1.5 1.1e-29 1.1e-29 2 71 .] 118 185 .. 117 185 .. 0.98
Alignments for each domain:
== domain 1 score: 88.8 bits; conditional E-value: 1.1e-29
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
+ l+rllPlk+v+l +yd+ +++l++++vt++++yl+L++ ++pe++fq+w+rlv++L+++ls+t+kd+
Q6NXP2 118 INLSRLLPLKYVELRIYDRLQRILRVRTVTEKIYYLKLHE--KHPEIVFQFWVRLVKILQKGLSITTKDP 185
579*************************************..**************************96 PP
Or compare Q6NXP2 to CDD or PaperBLAST