Q71RC9 has 77 amino acids
Query: SMIM5_18_22 [M=56]
Accession: PF15831.9
Description: Small integral membrane protein 5/18/22
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-28 84.8 9.6 2.6e-28 84.6 9.6 1.1 1 Q71RC9
Domain annotation for each sequence (and alignments):
>> Q71RC9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.6 9.6 2.6e-28 2.6e-28 1 56 [] 8 62 .. 8 62 .. 0.99
Alignments for each domain:
== domain 1 score: 84.6 bits; conditional E-value: 2.6e-28
SMIM5_18_22 1 qelesvlqevllrLqslqpfqsewdiaaFvvlllFigtVllLlllvilycccscCc 56
qe+++v++++ll+Lq+l p++++++i+aF+v++lF++tVllLll+++++cc++cCc
Q71RC9 8 QEMRAVGERLLLKLQRL-PQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHCCC 62
89***************.************************************** PP
Or compare Q71RC9 to CDD or PaperBLAST