Q7CHH5 has 186 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 46.7 0.6 1.3e-15 43.8 0.1 2.3 2 Q7CHH5 Domain annotation for each sequence (and alignments): >> Q7CHH5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.1 1.3e-15 1.3e-15 14 79 .] 39 104 .. 35 104 .. 0.97 2 ? 0.7 0.0 0.039 0.039 5 22 .. 131 148 .. 127 182 .. 0.61 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.3e-15 CM_2 14 LlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 L++eR++++k++a yK+en+lp+ d+ +ee+v++ ++++ae+lgl+ e ++ ++ + i++ +a+Q+ Q7CHH5 39 LINERLSYMKDVAGYKAENHLPIEDRIQEEKVINSAMAQAESLGLNGESIKPLMVAQINAAKAIQY 104 9**************************************************************996 PP == domain 2 score: 0.7 bits; conditional E-value: 0.039 CM_2 5 deiDrelleLlaeRmela 22 e+ ++le +ae ++ + Q7CHH5 131 GELSTKILEQIAEELKTC 148 555555555555444433 PP
Or compare Q7CHH5 to CDD or PaperBLAST