Q7ULG4 has 137 amino acids
Query: DUF3302 [M=77]
Accession: PF11742.12
Description: Protein of unknown function (DUF3302)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.8e-21 60.8 2.5 7.5e-21 60.4 2.5 1.2 1 Q7ULG4
Domain annotation for each sequence (and alignments):
>> Q7ULG4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.4 2.5 7.5e-21 7.5e-21 3 67 .. 37 100 .. 35 110 .. 0.88
Alignments for each domain:
== domain 1 score: 60.4 bits; conditional E-value: 7.5e-21
DUF3302 3 ylalvvLivvvlvvvygiivlhdiPyeiakrRnhPhadaisvagWvsLltlhvlWPflliWally 67
+++lv L+v ++ +++ i+ l +P++ia+rR+hP+ada++vagW L t+ ++W ++++Wa +
Q7ULG4 37 IVSLVFLLVFAVLILACIVGLAALPGKIARRRHHPFADAVNVAGWLGLPTG-IVWVLAMVWAHMG 100
77888888888899999999***************************9886.78********986 PP
Or compare Q7ULG4 to CDD or PaperBLAST