Q7ULG4 has 137 amino acids
Query: DUF3302 [M=77] Accession: PF11742.13 Description: Protein of unknown function (DUF3302) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-21 60.8 2.5 7.5e-21 60.4 2.5 1.2 1 Q7ULG4 Domain annotation for each sequence (and alignments): >> Q7ULG4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.4 2.5 7.5e-21 7.5e-21 3 67 .. 37 100 .. 35 110 .. 0.88 Alignments for each domain: == domain 1 score: 60.4 bits; conditional E-value: 7.5e-21 DUF3302 3 ylalvvLivvvlvvvygiivlhdiPyeiakrRnhPhadaisvagWvsLltlhvlWPflliWally 67 +++lv L+v ++ +++ i+ l +P++ia+rR+hP+ada++vagW L t+ ++W ++++Wa + Q7ULG4 37 IVSLVFLLVFAVLILACIVGLAALPGKIARRRHHPFADAVNVAGWLGLPTG-IVWVLAMVWAHMG 100 77888888888899999999***************************9886.78********986 PP
Or compare Q7ULG4 to CDD or PaperBLAST