Q7VYU1 has 186 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-38 116.2 51.1 1.8e-20 59.3 13.8 3.1 3 Q7VYU1 Domain annotation for each sequence (and alignments): >> Q7VYU1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.6 11.3 8.2e-17 8.2e-17 1 71 [. 19 88 .. 19 89 .. 0.94 2 ! 59.3 13.8 1.8e-20 1.8e-20 1 73 [] 76 147 .. 76 147 .. 0.95 3 ! 34.7 10.0 8.6e-13 8.6e-13 1 49 [. 133 181 .. 133 185 .. 0.94 Alignments for each domain: == domain 1 score: 47.6 bits; conditional E-value: 8.2e-17 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGlll 71 l+G++++++G++a+++Pg++l alv++ G+++l++Gi+ lva+++ r+ ++++ w l+l+G+ i+aG+ Q7VYU1 19 LRGVVAVLFGLMAVLMPGITLSALVLVWGAFALADGIFALVAGWRIRD-QDKPLWPLILVGLTGIAAGIAT 88 68******************************************8888.66789*999**********986 PP == domain 2 score: 59.3 bits; conditional E-value: 1.8e-20 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllllf 73 l+G+ i++Gi+ ++wPg+++l+l ++i+++++++G++q++aa+++rk ++wl+ lsG+l+i++G+lllf Q7VYU1 76 LVGLTGIAAGIATFAWPGLTALVLLYIIAFWAVIGGVFQIAAAIRFRKDIE-NEWLHGLSGALSIVFGALLLF 147 689*****************************************9999665.69*****************98 PP == domain 3 score: 34.7 bits; conditional E-value: 8.6e-13 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkk 49 l+G l+i++G+l+l+ Pga +lalv++iGv+++++G++ l+ af+++++ Q7VYU1 133 LSGALSIVFGALLLFQPGAGALALVWVIGVYAVLFGVLLLALAFRLKNH 181 579*****************************************88875 PP
Or compare Q7VYU1 to CDD or PaperBLAST