PaperBLAST – Find papers about a protein or its homologs

 

Align Q7WY72 to PF04025 (RemA-like)

Q7WY72 has 89 amino acids

Query:       RemA-like  [M=73]
Accession:   PF04025.18
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.5e-41  126.7   0.5    1.8e-41  126.4   0.5    1.1  1  Q7WY72    


Domain annotation for each sequence (and alignments):
>> Q7WY72  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  126.4   0.5   1.8e-41   1.8e-41       1      73 []       5      77 ..       5      77 .. 0.99

  Alignments for each domain:
  == domain 1  score: 126.4 bits;  conditional E-value: 1.8e-41
  RemA-like  1 liniGfgnvVnadriiaivspesapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
               liniGfgn+++a+r+i+ivspesapikr+iq+a+++g+lidaT+gr+tr+v+++ds+h+iLSa+qpet+a+Rl
     Q7WY72  5 LINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYGRRTRAVVVMDSDHIILSAVQPETVAHRL 77
               8**********************************************************************97 PP



Or compare Q7WY72 to CDD or PaperBLAST