Q80X50 has 1107 amino acids
Query: UBAP2-Lig [M=33]
Accession: PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-20 58.8 0.2 5.5e-20 57.5 0.2 1.7 1 Q80X50
Domain annotation for each sequence (and alignments):
>> Q80X50
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.5 0.2 5.5e-20 5.5e-20 2 33 .] 515 546 .. 515 546 .. 0.97
Alignments for each domain:
== domain 1 score: 57.5 bits; conditional E-value: 5.5e-20
UBAP2-Lig 2 pSkIPasAVEMPgdanissLDVQFGaldFGse 33
+SkIPa AVEMPg+a+is+L++QFGal+FGse
Q80X50 515 TSKIPALAVEMPGSADISGLNLQFGALQFGSE 546
5******************************8 PP
Or compare Q80X50 to CDD or PaperBLAST