Q812J9 has 289 amino acids
Query: DUF421 [M=135] Accession: PF04239.16 Description: YetF C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-48 150.3 0.1 2.1e-48 149.5 0.1 1.4 1 Q812J9 Domain annotation for each sequence (and alignments): >> Q812J9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.5 0.1 2.1e-48 2.1e-48 1 135 [] 84 217 .. 84 217 .. 0.99 Alignments for each domain: == domain 1 score: 149.5 bits; conditional E-value: 2.1e-48 DUF421 1 lkskklrrlidgkpivliknGkileenlkkarlsiddLlsqLRqqgifsisdVeyailEtnGqlsvlkkkekkpvtakdlnikkekenlsvplildGkilken 103 lk+k++r++++gk++vlik+Gkile+nlkk++++ d+Ll+ LR + fs+++Ve+a+lE++G+l+vl+kk+++p+takd+++k+++e+ ++++i+dG++l+e Q812J9 84 LKNKTARDFFEGKSTVLIKDGKILEDNLKKEKYTSDELLELLRGKSAFSVAEVEFAVLEPSGELNVLLKKDSQPLTAKDIGLKVPNEKEPQTVIMDGNVLDEP 186 699**************************************************************************************************** PP DUF421 104 LeeigkdeewLkeelkkqgikdledvflaevd 135 L++ g++++wL++el+k g+ +e+vfl++vd Q812J9 187 LSASGHNRAWLHSELEKIGVV-IENVFLGQVD 217 *********************.******9986 PP
Or compare Q812J9 to CDD or PaperBLAST