PaperBLAST – Find papers about a protein or its homologs

 

Align Q8AVR4 to PF06840 (PDC10_C)

Q8AVR4 has 212 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    9.7e-45  136.9   1.5    1.9e-44  136.0   1.5    1.5  1  Q8AVR4    


Domain annotation for each sequence (and alignments):
>> Q8AVR4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.0   1.5   1.9e-44   1.9e-44       1      90 []      74     161 ..      74     161 .. 0.98

  Alignments for each domain:
  == domain 1  score: 136.0 bits;  conditional E-value: 1.9e-44
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              vn++eslLr+a++ dveey++er e efqeln+karaLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
   Q8AVR4  74 VNFTESLLRMAAD-DVEEYMVERPEPEFQELNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161
              8************.********************************************************************.8899997 PP



Or compare Q8AVR4 to CDD or PaperBLAST