Q8AVR4 has 212 amino acids
Query: PDC10_C [M=90]
Accession: PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-45 136.9 1.5 1.9e-44 136.0 1.5 1.5 1 Q8AVR4
Domain annotation for each sequence (and alignments):
>> Q8AVR4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 136.0 1.5 1.9e-44 1.9e-44 1 90 [] 74 161 .. 74 161 .. 0.98
Alignments for each domain:
== domain 1 score: 136.0 bits; conditional E-value: 1.9e-44
PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90
vn++eslLr+a++ dveey++er e efqeln+karaLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
Q8AVR4 74 VNFTESLLRMAAD-DVEEYMVERPEPEFQELNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161
8************.********************************************************************.8899997 PP
Or compare Q8AVR4 to CDD or PaperBLAST