Q8BTC1 has 67 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-30 89.9 1.4 3.9e-30 89.6 1.4 1.1 1 Q8BTC1
Domain annotation for each sequence (and alignments):
>> Q8BTC1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.6 1.4 3.9e-30 3.9e-30 1 46 [] 1 46 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 89.6 bits; conditional E-value: 3.9e-30
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46
mP+Gv+w++Ylk++s+s+l+M+aGAqvVH+yY+Pdltip+i++k++
Q8BTC1 1 MPGGVPWSAYLKMLSSSLLAMCAGAQVVHWYYRPDLTIPEIPPKPG 46
9******************************************985 PP
Or compare Q8BTC1 to CDD or PaperBLAST