Q8CI78 has 450 amino acids
Query: DUF155 [M=173] Accession: PF02582.18 Description: RMND1/Sif2-Sif3/Mrx10, DUF155 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-56 176.4 1.6 4.2e-56 175.9 1.6 1.2 1 Q8CI78 Domain annotation for each sequence (and alignments): >> Q8CI78 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 175.9 1.6 4.2e-56 4.2e-56 1 173 [] 227 404 .. 227 404 .. 0.98 Alignments for each domain: == domain 1 score: 175.9 bits; conditional E-value: 4.2e-56 DUF155 1 vfvfryGvvVfwglteeeekeflkklkkfaeeeskseeeeeetEeleyvydekesrikndlivlesd.....sllaklaiShalaqSvkLsvlEesleklles 98 +f+fr+G+ Vfw+++e+ k++++ l+++++++++ ++ + e+Eel+y+++e +s+++++ i l+s+ +l+k+a+S+al+ SvkL+++E+ l+k++es Q8CI78 227 IFLFREGAAVFWNVKEKTMKHVMQVLERHETQPYEVALVHWENEELNYIKTEGQSKLHRGEIKLNSEldlddAILEKFAFSNALCLSVKLAIWEATLDKFIES 329 7****************************9999999999999********9999**********9999*********************************** PP DUF155 99 tesipeeLaktgklklsrkellkkiGellklradlnlkselldtPdlfWeepeleklYealseyleikeRievLn 173 ++sipe L+ ++k+kls+ke+++k+Gel+ lr+++nl+s++l tPd++W++++le+lY++++++l i +R++v+n Q8CI78 330 IQSIPEALKAGKKVKLSHKEVMQKMGELFALRHRINLSSDFLITPDFYWDRANLEELYDKTCQFLSITRRVKVMN 404 **************************************************************************9 PP
Or compare Q8CI78 to CDD or PaperBLAST