Q8IYT1 has 594 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-29 88.3 0.1 2.9e-29 87.4 0.1 1.4 1 Q8IYT1
Domain annotation for each sequence (and alignments):
>> Q8IYT1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.4 0.1 2.9e-29 2.9e-29 1 69 [. 115 183 .. 115 184 .. 0.97
Alignments for each domain:
== domain 1 score: 87.4 bits; conditional E-value: 2.9e-29
GARIL_Rab2_bd 1 tleltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttek 69
+leltrllPl fv++sv d+ekq+l+lk++tgRs+yl+L++ d++++lf++w++l++lLr+p++++++
Q8IYT1 115 NLELTRLLPLRFVRISVQDHEKQQLRLKFATGRSCYLQLCPALDTRDDLFAYWEKLIYLLRPPMESNSS 183
59**************************************************************98875 PP
Or compare Q8IYT1 to CDD or PaperBLAST