PaperBLAST – Find papers about a protein or its homologs

 

Align Q8N5G0 to PF15061 (DUF4538)

Q8N5G0 has 67 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.11
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.9e-32   97.1   0.0    2.1e-32   97.0   0.0    1.0  1  Q8N5G0    


Domain annotation for each sequence (and alignments):
>> Q8N5G0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.0   0.0   2.1e-32   2.1e-32       1      57 []       2      58 ..       2      58 .. 0.98

  Alignments for each domain:
  == domain 1  score: 97.0 bits;  conditional E-value: 2.1e-32
  DUF4538  1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
             +r+l++al++gGf++lig+A+YPI+++P+++ eeYkk+Q+inragi qe++qP+g+k
   Q8N5G0  2 SRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLK 58
             69*****************************************************97 PP



Or compare Q8N5G0 to CDD or PaperBLAST