Q8N7N1 has 296 amino acids
Query: FAM86 [M=94] Accession: PF14904.11 Description: Family of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-38 116.2 0.0 4.7e-38 115.5 0.0 1.3 1 Q8N7N1 Domain annotation for each sequence (and alignments): >> Q8N7N1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.5 0.0 4.7e-38 4.7e-38 2 76 .. 7 81 .. 6 88 .. 0.95 Alignments for each domain: == domain 1 score: 115.5 bits; conditional E-value: 4.7e-38 FAM86 2 aeaeellkeferrFlamrrlesfPwqaleeeLkeskssellkeilkktvkHplckkfppsvkyrrlfLseLikkh 76 a++e ll+ ferrFla+r+l+sfPwq+le +L++s++sell++il+ktv+Hp+c+k+ppsvky+++fLseLikk Q8N7N1 7 AGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYAWCFLSELIKKS 81 568899*******************************************************************97 PP
Or compare Q8N7N1 to CDD or PaperBLAST