Q8N7N1 has 296 amino acids
Query: FAM86 [M=94]
Accession: PF14904.10
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-38 116.2 0.0 4.7e-38 115.5 0.0 1.3 1 Q8N7N1
Domain annotation for each sequence (and alignments):
>> Q8N7N1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 115.5 0.0 4.7e-38 4.7e-38 2 76 .. 7 81 .. 6 88 .. 0.95
Alignments for each domain:
== domain 1 score: 115.5 bits; conditional E-value: 4.7e-38
FAM86 2 aeaeellkeferrFlamrrlesfPwqaleeeLkeskssellkeilkktvkHplckkfppsvkyrrlfLseLikkh 76
a++e ll+ ferrFla+r+l+sfPwq+le +L++s++sell++il+ktv+Hp+c+k+ppsvky+++fLseLikk
Q8N7N1 7 AGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYAWCFLSELIKKS 81
568899*******************************************************************97 PP
Or compare Q8N7N1 to CDD or PaperBLAST