Q8N8U3 has 475 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.11
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-17 50.1 0.0 2.5e-17 49.1 0.0 1.5 1 Q8N8U3
Domain annotation for each sequence (and alignments):
>> Q8N8U3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.1 0.0 2.5e-17 2.5e-17 22 104 .. 235 317 .. 219 325 .. 0.91
Alignments for each domain:
== domain 1 score: 49.1 bits; conditional E-value: 2.5e-17
DUF4939 22 rnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefG 104
p+ + +f+G+s++lpef+vq sym v + + ++a v f+ ++Gra w ++ +spll++ ++f+ ++++f
Q8N8U3 235 DFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLLLDIQSPLLEQCESFIPVLQDTFD 317
57999**********************************************************************99999886 PP
Or compare Q8N8U3 to CDD or PaperBLAST