Q8N912 has 160 amino acids
Query: DUF4658 [M=123] Accession: PF15555.10 Description: Domain of unknown function (DUF4658) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-61 190.0 3.9 1.1e-60 189.5 3.9 1.2 1 Q8N912 Domain annotation for each sequence (and alignments): >> Q8N912 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 189.5 3.9 1.1e-60 1.1e-60 2 123 .] 34 155 .. 33 155 .. 0.99 Alignments for each domain: == domain 1 score: 189.5 bits; conditional E-value: 1.1e-60 DUF4658 2 raeregdrkcPpsilrrsrqervsrgaePqrtarrvrfrePlevavhyiaardstaaikvpsrpaprggslllrlsvCillvvvlglycgrakpvalaledl 103 raere++rkcPpsil+rsr+e + ++a+Pqrt+rrv freP+ v vhyia +++ta+++vp+rp+p+ggslll+l vC+llv++lglycgrakpva+aledl Q8N912 34 RAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCGRAKPVATALEDL 135 8***************************************************************************************************** PP DUF4658 104 rarllvlalrlrhaalecWh 123 rarll l+l+lrh+al+cW+ Q8N912 136 RARLLGLVLHLRHVALTCWR 155 *******************7 PP
Or compare Q8N912 to CDD or PaperBLAST