Q8U4Q7 has 469 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-20 59.5 3.7 1.5e-20 59.5 3.7 2.9 3 Q8U4Q7 Domain annotation for each sequence (and alignments): >> Q8U4Q7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.6 0.1 0.018 0.018 44 54 .. 46 56 .. 35 68 .. 0.71 2 ? -1.4 0.0 0.15 0.15 7 33 .. 83 112 .. 77 120 .. 0.63 3 ! 59.5 3.7 1.5e-20 1.5e-20 1 68 [] 374 441 .. 374 441 .. 0.96 Alignments for each domain: == domain 1 score: 1.6 bits; conditional E-value: 0.018 DUF402 44 kyiDlyLDvvv 54 y+D+++D+ Q8U4Q7 46 SYEDFDVDIYD 56 79******974 PP == domain 2 score: -1.4 bits; conditional E-value: 0.15 DUF402 7 lplgewynvtkflde...dgrlkgwYvnia 33 ++++++y+ + +++ +++++ +Yv+i+ Q8U4Q7 83 FFRKLPYKLHGIYKGlvvKRDDRFVYVDIG 112 666666666666665432336666788886 PP == domain 3 score: 59.5 bits; conditional E-value: 1.5e-20 DUF402 1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 d+a++ + g+w+ v++++d+dg+lkg ni+tp e+++++ +y+Dl++D+v++pdg+ e++D + L Q8U4Q7 374 DYAITEIEAGKWWFVHRYYDKDGNLKGEFYNINTPVEIYPDKARYVDLEVDIVRWPDGKKEIIDKEKL 441 6889999*******************************9999**********************9865 PP
Or compare Q8U4Q7 to CDD or PaperBLAST