Q8UWG9 has 494 amino acids
Query: DUF3522 [M=184] Accession: PF12036.12 Description: Protein of unknown function (DUF3522) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-14 38.2 3.9 9.6e-14 38.2 3.9 2.0 2 Q8UWG9 Domain annotation for each sequence (and alignments): >> Q8UWG9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.23 0.23 90 129 .. 149 188 .. 119 212 .. 0.71 2 ! 38.2 3.9 9.6e-14 9.6e-14 3 43 .. 453 493 .. 451 494 .] 0.94 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.23 DUF3522 90 dldealksllkylglllvailqekdrwnlantlipilvgl 129 +l +++++++ ++g + + ++ + +w+ + +++ +g+ Q8UWG9 149 TLPQSFQRIITCTGNVNCSVSLDSLPWEKWLQIMVESLGT 188 3467778888888888888888888888887776655555 PP == domain 2 score: 38.2 bits; conditional E-value: 9.6e-14 DUF3522 3 llqlllltlSnlaflpaiyvalkrklvfEavvylftmlfSl 43 l++llltlSnl+flpai+va++r +++Ea vy++tm+fS+ Q8UWG9 453 NLATLLLTLSNLMFLPAIAVAVYRYYLVEASVYTYTMFFST 493 5789************************************8 PP
Or compare Q8UWG9 to CDD or PaperBLAST