Q91XE8 has 189 amino acids
Query: DUF4149 [M=102]
Accession: PF13664.11
Description: Domain of unknown function (DUF4149)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-31 95.3 7.7 1.2e-31 95.3 7.7 1.5 2 Q91XE8
Domain annotation for each sequence (and alignments):
>> Q91XE8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 95.3 7.7 1.2e-31 1.2e-31 1 99 [. 17 116 .. 17 119 .. 0.97
2 ? -2.5 0.0 0.33 0.33 40 83 .. 159 173 .. 147 184 .. 0.54
Alignments for each domain:
== domain 1 score: 95.3 bits; conditional E-value: 1.2e-31
DUF4149 1 lllalllGslvfvtfvvapvlfkaLprqqfgalqsklFpvyfllglalavvllltellrg.sellakaeklqllllavvllltllnafylePritalkae 99
l+l+ ++G++v+vtf+++++lf++Lpr++fg +qsk+Fpvyf+++l++a++ l++ ++++ + l+ +e +ql ll+++l l+ +na +le r+ta++++
Q91XE8 17 LVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHVSLGCAFINLCILAPQRaWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRA 116
678999****************************************************99**************************************86 PP
== domain 2 score: -2.5 bits; conditional E-value: 0.33
DUF4149 40 vyfllglalavvllltellrgsellakaeklqllllavvllltl 83
y +l++++ +l + l
Q91XE8 159 HYHGLSSLC-----------------------------NLGCLL 173
344444444.............................333333 PP
Or compare Q91XE8 to CDD or PaperBLAST