Q93YU8 has 796 amino acids
Query: DUF630 [M=59]
Accession: PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-30 90.7 4.7 1.1e-29 88.7 4.7 2.2 1 Q93YU8
Domain annotation for each sequence (and alignments):
>> Q93YU8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.7 4.7 1.1e-29 1.1e-29 1 59 [] 1 59 [. 1 59 [. 0.99
Alignments for each domain:
== domain 1 score: 88.7 bits; conditional E-value: 1.1e-29
DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59
MGcaaSkld+e+av++C++R+rl+k+av+aR++LAaaH++Y++SLr +g+aL+ Fa +e
Q93YU8 1 MGCAASKLDNEDAVRRCKDRRRLMKEAVYARHHLAAAHADYCRSLRITGSALSSFASGE 59
*******************************************************9986 PP
Or compare Q93YU8 to CDD or PaperBLAST