Q96AQ1 has 378 amino acids
Query: CCDC92 [M=57] Accession: PF14916.10 Description: Coiled-coil domain of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-23 68.2 9.0 5e-23 67.1 9.0 1.6 1 Q96AQ1 Domain annotation for each sequence (and alignments): >> Q96AQ1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.1 9.0 5e-23 5e-23 5 54 .. 51 100 .. 47 102 .. 0.93 Alignments for each domain: == domain 1 score: 67.1 bits; conditional E-value: 5e-23 CCDC92 5 qsleksikFLqeqhaatLkgLHkEIerLqkrnkdLtfklvmkegesskkg 54 +leks++FLq+qh+++L +LH+EIe+L+++nkdL++kl+m++ ++k+g Q96AQ1 51 LDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDG 100 689****************************************9998876 PP
Or compare Q96AQ1 to CDD or PaperBLAST