PaperBLAST – Find papers about a protein or its homologs

 

Align Q96AQ1 to PF14916 (CCDC92)

Q96AQ1 has 378 amino acids

Query:       CCDC92  [M=57]
Accession:   PF14916.10
Description: Coiled-coil domain of unknown function
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-23   68.2   9.0      5e-23   67.1   9.0    1.6  1  Q96AQ1    


Domain annotation for each sequence (and alignments):
>> Q96AQ1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.1   9.0     5e-23     5e-23       5      54 ..      51     100 ..      47     102 .. 0.93

  Alignments for each domain:
  == domain 1  score: 67.1 bits;  conditional E-value: 5e-23
  CCDC92   5 qsleksikFLqeqhaatLkgLHkEIerLqkrnkdLtfklvmkegesskkg 54 
              +leks++FLq+qh+++L +LH+EIe+L+++nkdL++kl+m++  ++k+g
  Q96AQ1  51 LDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDG 100
             689****************************************9998876 PP



Or compare Q96AQ1 to CDD or PaperBLAST