PaperBLAST – Find papers about a protein or its homologs

 

Align Q96GE9 to PF15055 (DUF4536)

Q96GE9 has 116 amino acids

Query:       DUF4536  [M=47]
Accession:   PF15055.11
Description: Domain of unknown function (DUF4536)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      1e-26   79.3   1.6    1.6e-26   78.7   1.6    1.3  1  Q96GE9    


Domain annotation for each sequence (and alignments):
>> Q96GE9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.7   1.6   1.6e-26   1.6e-26       2      47 .]      47      92 ..      46      92 .. 0.98

  Alignments for each domain:
  == domain 1  score: 78.7 bits;  conditional E-value: 1.6e-26
  DUF4536  2 ClsCRllSGsGLigaGaYvyvqArrrlkqggkptmgtiaqvavalg 47
             C+sCR+lSG GL+gaG+Yvy++Ar+++k+g++p++ ti+q++++l+
   Q96GE9 47 CWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLS 92
             *******************************************997 PP



Or compare Q96GE9 to CDD or PaperBLAST