PaperBLAST – Find papers about a protein or its homologs

 

Align Q96LY2 to PF14916 (CCDC92)

Q96LY2 has 380 amino acids

Query:       CCDC92  [M=57]
Accession:   PF14916.10
Description: Coiled-coil domain of unknown function
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.4e-23   66.9   8.0    5.4e-23   66.9   8.0    1.7  2  Q96LY2    


Domain annotation for each sequence (and alignments):
>> Q96LY2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   66.9   8.0   5.4e-23   5.4e-23       5      54 ..      51     100 ..      47     102 .. 0.93
   2 ?   -4.6   1.1         1         1      15      24 ..     289     298 ..     287     299 .. 0.55

  Alignments for each domain:
  == domain 1  score: 66.9 bits;  conditional E-value: 5.4e-23
  CCDC92   5 qsleksikFLqeqhaatLkgLHkEIerLqkrnkdLtfklvmkegesskkg 54 
              +leks++FLq+qh+++L +LH+EIe+L+++nkdL +kl+m++  ++k+g
  Q96LY2  51 LDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDG 100
             689****************************************9998876 PP

  == domain 2  score: -4.6 bits;  conditional E-value: 1
  CCDC92  15 qeqhaatLkg 24 
             q+q  + Lk 
  Q96LY2 289 QTQELQHLKS 298
             5555555554 PP



Or compare Q96LY2 to CDD or PaperBLAST